Description
Product Description
Protein Description: netrin 1
Gene Name: NTN1
Alternative Gene Name: NTN1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020902: 100%, ENSRNOG00000003947: 100%
Entrez Gene ID: 9423
Uniprot ID: O95631
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NTN1
Alternative Gene Name: NTN1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020902: 100%, ENSRNOG00000003947: 100%
Entrez Gene ID: 9423
Uniprot ID: O95631
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCK |
Gene Sequence | GDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCK |
Gene ID - Mouse | ENSMUSG00000020902 |
Gene ID - Rat | ENSRNOG00000003947 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NTN1 pAb (ATL-HPA056419) | |
Datasheet | Anti NTN1 pAb (ATL-HPA056419) Datasheet (External Link) |
Vendor Page | Anti NTN1 pAb (ATL-HPA056419) at Atlas Antibodies |
Documents & Links for Anti NTN1 pAb (ATL-HPA056419) | |
Datasheet | Anti NTN1 pAb (ATL-HPA056419) Datasheet (External Link) |
Vendor Page | Anti NTN1 pAb (ATL-HPA056419) |