Anti NTN1 pAb (ATL-HPA056419)

Catalog No:
ATL-HPA056419-25
$395.00

Description

Product Description

Protein Description: netrin 1
Gene Name: NTN1
Alternative Gene Name: NTN1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020902: 100%, ENSRNOG00000003947: 100%
Entrez Gene ID: 9423
Uniprot ID: O95631
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCK
Gene Sequence GDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCK
Gene ID - Mouse ENSMUSG00000020902
Gene ID - Rat ENSRNOG00000003947
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NTN1 pAb (ATL-HPA056419)
Datasheet Anti NTN1 pAb (ATL-HPA056419) Datasheet (External Link)
Vendor Page Anti NTN1 pAb (ATL-HPA056419) at Atlas Antibodies

Documents & Links for Anti NTN1 pAb (ATL-HPA056419)
Datasheet Anti NTN1 pAb (ATL-HPA056419) Datasheet (External Link)
Vendor Page Anti NTN1 pAb (ATL-HPA056419)

Product Description

Protein Description: netrin 1
Gene Name: NTN1
Alternative Gene Name: NTN1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020902: 100%, ENSRNOG00000003947: 100%
Entrez Gene ID: 9423
Uniprot ID: O95631
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCK
Gene Sequence GDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCK
Gene ID - Mouse ENSMUSG00000020902
Gene ID - Rat ENSRNOG00000003947
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NTN1 pAb (ATL-HPA056419)
Datasheet Anti NTN1 pAb (ATL-HPA056419) Datasheet (External Link)
Vendor Page Anti NTN1 pAb (ATL-HPA056419) at Atlas Antibodies

Documents & Links for Anti NTN1 pAb (ATL-HPA056419)
Datasheet Anti NTN1 pAb (ATL-HPA056419) Datasheet (External Link)
Vendor Page Anti NTN1 pAb (ATL-HPA056419)