Description
Product Description
Protein Description: N-terminal Xaa-Pro-Lys N-methyltransferase 1
Gene Name: NTMT1
Alternative Gene Name: AD-003, C9orf32, HOMT1A, METTL11A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026857: 97%, ENSRNOG00000024809: 97%
Entrez Gene ID: 28989
Uniprot ID: Q9BV86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NTMT1
Alternative Gene Name: AD-003, C9orf32, HOMT1A, METTL11A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026857: 97%, ENSRNOG00000024809: 97%
Entrez Gene ID: 28989
Uniprot ID: Q9BV86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT |
Gene Sequence | MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT |
Gene ID - Mouse | ENSMUSG00000026857 |
Gene ID - Rat | ENSRNOG00000024809 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NTMT1 pAb (ATL-HPA058420) | |
Datasheet | Anti NTMT1 pAb (ATL-HPA058420) Datasheet (External Link) |
Vendor Page | Anti NTMT1 pAb (ATL-HPA058420) at Atlas Antibodies |
Documents & Links for Anti NTMT1 pAb (ATL-HPA058420) | |
Datasheet | Anti NTMT1 pAb (ATL-HPA058420) Datasheet (External Link) |
Vendor Page | Anti NTMT1 pAb (ATL-HPA058420) |