Anti NT5C3B pAb (ATL-HPA057095)

Atlas Antibodies

Catalog No: ATL-HPA057095-25

• 

Product Description

Protein Description: 5'-nucleotidase, cytosolic IIIB
Gene Name: NT5C3B
Alternative Gene Name: MGC20781, NT5C3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017176: 87%, ENSRNOG00000016475: 87%
Entrez Gene ID: 115024
Uniprot ID: Q969T7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVSNYMDFNEDGFLQGFKGQLIHTYNKNSSVCENCGYFQQLEGKTNVILLGDSIG
• Gene Sequence: IVSNYMDFNEDGFLQGFKGQLIHTYNKNSSVCENCGYFQQLEGKTNVILLGDSIG
• Gene ID - Mouse: ENSMUSG00000017176
• Gene ID - Rat: ENSRNOG00000016475
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.