Protein Description: NOP2/Sun domain family, member 5
Gene Name: NSUN5
Alternative Gene Name: (NOL1), FLJ10267, NOL1R, NSUN5A, p120, WBSCR20, WBSCR20A, Ynl022cL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000916: 88%, ENSRNOG00000001450: 88%
Entrez Gene ID: 55695
Uniprot ID: Q96P11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NSUN5
Alternative Gene Name: (NOL1), FLJ10267, NOL1R, NSUN5A, p120, WBSCR20, WBSCR20A, Ynl022cL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000916: 88%, ENSRNOG00000001450: 88%
Entrez Gene ID: 55695
Uniprot ID: Q96P11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL |
Documents & Links for Anti NSUN5 pAb (ATL-HPA020536 w/enhanced validation) | |
Datasheet | Anti NSUN5 pAb (ATL-HPA020536 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NSUN5 pAb (ATL-HPA020536 w/enhanced validation) at Atlas |
Documents & Links for Anti NSUN5 pAb (ATL-HPA020536 w/enhanced validation) | |
Datasheet | Anti NSUN5 pAb (ATL-HPA020536 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NSUN5 pAb (ATL-HPA020536 w/enhanced validation) |