Anti NSUN3 pAb (ATL-HPA057979)

Catalog No:
ATL-HPA057979-25
$447.00

Description

Product Description

Protein Description: NOP2/Sun domain family, member 3
Gene Name: NSUN3
Alternative Gene Name: FLJ22609
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050312: 80%, ENSRNOG00000054275: 60%
Entrez Gene ID: 63899
Uniprot ID: Q9H649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQYSKELGDAWNTVREILTSPSCWQYAVLLNRFNYPFELEKDLHLKGYHTLSQGSLPNYPKSVKCYLSRTPGRIPSERHQIGNLKKYYLLNAASLL
Gene Sequence KQYSKELGDAWNTVREILTSPSCWQYAVLLNRFNYPFELEKDLHLKGYHTLSQGSLPNYPKSVKCYLSRTPGRIPSERHQIGNLKKYYLLNAASLL
Gene ID - Mouse ENSMUSG00000050312
Gene ID - Rat ENSRNOG00000054275
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NSUN3 pAb (ATL-HPA057979)
Datasheet Anti NSUN3 pAb (ATL-HPA057979) Datasheet (External Link)
Vendor Page Anti NSUN3 pAb (ATL-HPA057979) at Atlas Antibodies

Documents & Links for Anti NSUN3 pAb (ATL-HPA057979)
Datasheet Anti NSUN3 pAb (ATL-HPA057979) Datasheet (External Link)
Vendor Page Anti NSUN3 pAb (ATL-HPA057979)

Product Description

Protein Description: NOP2/Sun domain family, member 3
Gene Name: NSUN3
Alternative Gene Name: FLJ22609
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050312: 80%, ENSRNOG00000054275: 60%
Entrez Gene ID: 63899
Uniprot ID: Q9H649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQYSKELGDAWNTVREILTSPSCWQYAVLLNRFNYPFELEKDLHLKGYHTLSQGSLPNYPKSVKCYLSRTPGRIPSERHQIGNLKKYYLLNAASLL
Gene Sequence KQYSKELGDAWNTVREILTSPSCWQYAVLLNRFNYPFELEKDLHLKGYHTLSQGSLPNYPKSVKCYLSRTPGRIPSERHQIGNLKKYYLLNAASLL
Gene ID - Mouse ENSMUSG00000050312
Gene ID - Rat ENSRNOG00000054275
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NSUN3 pAb (ATL-HPA057979)
Datasheet Anti NSUN3 pAb (ATL-HPA057979) Datasheet (External Link)
Vendor Page Anti NSUN3 pAb (ATL-HPA057979) at Atlas Antibodies

Documents & Links for Anti NSUN3 pAb (ATL-HPA057979)
Datasheet Anti NSUN3 pAb (ATL-HPA057979) Datasheet (External Link)
Vendor Page Anti NSUN3 pAb (ATL-HPA057979)