Description
Product Description
Protein Description: NOP2/Sun domain family, member 3
Gene Name: NSUN3
Alternative Gene Name: FLJ22609
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050312: 80%, ENSRNOG00000054275: 60%
Entrez Gene ID: 63899
Uniprot ID: Q9H649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NSUN3
Alternative Gene Name: FLJ22609
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050312: 80%, ENSRNOG00000054275: 60%
Entrez Gene ID: 63899
Uniprot ID: Q9H649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KQYSKELGDAWNTVREILTSPSCWQYAVLLNRFNYPFELEKDLHLKGYHTLSQGSLPNYPKSVKCYLSRTPGRIPSERHQIGNLKKYYLLNAASLL |
Gene Sequence | KQYSKELGDAWNTVREILTSPSCWQYAVLLNRFNYPFELEKDLHLKGYHTLSQGSLPNYPKSVKCYLSRTPGRIPSERHQIGNLKKYYLLNAASLL |
Gene ID - Mouse | ENSMUSG00000050312 |
Gene ID - Rat | ENSRNOG00000054275 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NSUN3 pAb (ATL-HPA057979) | |
Datasheet | Anti NSUN3 pAb (ATL-HPA057979) Datasheet (External Link) |
Vendor Page | Anti NSUN3 pAb (ATL-HPA057979) at Atlas Antibodies |
Documents & Links for Anti NSUN3 pAb (ATL-HPA057979) | |
Datasheet | Anti NSUN3 pAb (ATL-HPA057979) Datasheet (External Link) |
Vendor Page | Anti NSUN3 pAb (ATL-HPA057979) |