Protein Description: neutral sphingomyelinase (N-SMase) activation associated factor
Gene Name: NSMAF
Alternative Gene Name: FAN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028245: 93%, ENSRNOG00000010234: 91%
Entrez Gene ID: 8439
Uniprot ID: Q92636
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NSMAF
Alternative Gene Name: FAN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028245: 93%, ENSRNOG00000010234: 91%
Entrez Gene ID: 8439
Uniprot ID: Q92636
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FELDVPGKVEDVVETLLQLHRASCLDKLGDQTAMITAILQSRLARTSFDKNRFQNISEKLHMECKAE |
Documents & Links for Anti NSMAF pAb (ATL-HPA023148) | |
Datasheet | Anti NSMAF pAb (ATL-HPA023148) Datasheet (External Link) |
Vendor Page | Anti NSMAF pAb (ATL-HPA023148) at Atlas |
Documents & Links for Anti NSMAF pAb (ATL-HPA023148) | |
Datasheet | Anti NSMAF pAb (ATL-HPA023148) Datasheet (External Link) |
Vendor Page | Anti NSMAF pAb (ATL-HPA023148) |