Protein Description: nuclear receptor interacting protein 3
Gene Name: NRIP3
Alternative Gene Name: C11orf14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034825: 91%, ENSRNOG00000013290: 90%
Entrez Gene ID: 56675
Uniprot ID: Q9NQ35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NRIP3
Alternative Gene Name: C11orf14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034825: 91%, ENSRNOG00000013290: 90%
Entrez Gene ID: 56675
Uniprot ID: Q9NQ35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQT |
| Documents & Links for Anti NRIP3 pAb (ATL-HPA072961) | |
| Datasheet | Anti NRIP3 pAb (ATL-HPA072961) Datasheet (External Link) |
| Vendor Page | Anti NRIP3 pAb (ATL-HPA072961) at Atlas |
| Documents & Links for Anti NRIP3 pAb (ATL-HPA072961) | |
| Datasheet | Anti NRIP3 pAb (ATL-HPA072961) Datasheet (External Link) |
| Vendor Page | Anti NRIP3 pAb (ATL-HPA072961) |