Anti NRBF2 pAb (ATL-HPA059477)

Catalog No:
ATL-HPA059477-100
$596.00

Description

Product Description

Protein Description: nuclear receptor binding factor 2
Gene Name: NRBF2
Alternative Gene Name: COPR1, COPR2, DKFZp564C1664, FLJ30395
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075000: 93%, ENSRNOG00000000641: 97%
Entrez Gene ID: 29982
Uniprot ID: Q96F24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNT
Gene Sequence MEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNT
Gene ID - Mouse ENSMUSG00000075000
Gene ID - Rat ENSRNOG00000000641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NRBF2 pAb (ATL-HPA059477)
Datasheet Anti NRBF2 pAb (ATL-HPA059477) Datasheet (External Link)
Vendor Page Anti NRBF2 pAb (ATL-HPA059477) at Atlas Antibodies

Documents & Links for Anti NRBF2 pAb (ATL-HPA059477)
Datasheet Anti NRBF2 pAb (ATL-HPA059477) Datasheet (External Link)
Vendor Page Anti NRBF2 pAb (ATL-HPA059477)

Product Description

Protein Description: nuclear receptor binding factor 2
Gene Name: NRBF2
Alternative Gene Name: COPR1, COPR2, DKFZp564C1664, FLJ30395
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075000: 93%, ENSRNOG00000000641: 97%
Entrez Gene ID: 29982
Uniprot ID: Q96F24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNT
Gene Sequence MEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNT
Gene ID - Mouse ENSMUSG00000075000
Gene ID - Rat ENSRNOG00000000641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NRBF2 pAb (ATL-HPA059477)
Datasheet Anti NRBF2 pAb (ATL-HPA059477) Datasheet (External Link)
Vendor Page Anti NRBF2 pAb (ATL-HPA059477) at Atlas Antibodies

Documents & Links for Anti NRBF2 pAb (ATL-HPA059477)
Datasheet Anti NRBF2 pAb (ATL-HPA059477) Datasheet (External Link)
Vendor Page Anti NRBF2 pAb (ATL-HPA059477)