Description
Product Description
Protein Description: nuclear receptor subfamily 4 group A member 1
Gene Name: NR4A1
Alternative Gene Name: GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023034: 94%, ENSRNOG00000007607: 92%
Entrez Gene ID: 3164
Uniprot ID: P22736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NR4A1
Alternative Gene Name: GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023034: 94%, ENSRNOG00000007607: 92%
Entrez Gene ID: 3164
Uniprot ID: P22736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS |
Gene Sequence | PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS |
Gene ID - Mouse | ENSMUSG00000023034 |
Gene ID - Rat | ENSRNOG00000007607 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NR4A1 pAb (ATL-HPA070142) | |
Datasheet | Anti NR4A1 pAb (ATL-HPA070142) Datasheet (External Link) |
Vendor Page | Anti NR4A1 pAb (ATL-HPA070142) at Atlas Antibodies |
Documents & Links for Anti NR4A1 pAb (ATL-HPA070142) | |
Datasheet | Anti NR4A1 pAb (ATL-HPA070142) Datasheet (External Link) |
Vendor Page | Anti NR4A1 pAb (ATL-HPA070142) |