Protein Description: nuclear receptor subfamily 4 group A member 1
Gene Name: NR4A1
Alternative Gene Name: GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023034: 94%, ENSRNOG00000007607: 92%
Entrez Gene ID: 3164
Uniprot ID: P22736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NR4A1
Alternative Gene Name: GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023034: 94%, ENSRNOG00000007607: 92%
Entrez Gene ID: 3164
Uniprot ID: P22736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS |
| Documents & Links for Anti NR4A1 pAb (ATL-HPA070142) | |
| Datasheet | Anti NR4A1 pAb (ATL-HPA070142) Datasheet (External Link) |
| Vendor Page | Anti NR4A1 pAb (ATL-HPA070142) at Atlas |
| Documents & Links for Anti NR4A1 pAb (ATL-HPA070142) | |
| Datasheet | Anti NR4A1 pAb (ATL-HPA070142) Datasheet (External Link) |
| Vendor Page | Anti NR4A1 pAb (ATL-HPA070142) |