Protein Description: nuclear receptor subfamily 3, group C, member 2
Gene Name: NR3C2
Alternative Gene Name: MLR, MR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031618: 95%, ENSRNOG00000034007: 98%
Entrez Gene ID: 4306
Uniprot ID: P08235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NR3C2
Alternative Gene Name: MLR, MR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031618: 95%, ENSRNOG00000034007: 98%
Entrez Gene ID: 4306
Uniprot ID: P08235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTL |
Documents & Links for Anti NR3C2 pAb (ATL-HPA074979) | |
Datasheet | Anti NR3C2 pAb (ATL-HPA074979) Datasheet (External Link) |
Vendor Page | Anti NR3C2 pAb (ATL-HPA074979) at Atlas |
Documents & Links for Anti NR3C2 pAb (ATL-HPA074979) | |
Datasheet | Anti NR3C2 pAb (ATL-HPA074979) Datasheet (External Link) |
Vendor Page | Anti NR3C2 pAb (ATL-HPA074979) |