Protein Description: nuclear receptor subfamily 2, group C, member 1
Gene Name: NR2C1
Alternative Gene Name: TR2, TR2-11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005897: 73%, ENSRNOG00000006983: 72%
Entrez Gene ID: 7181
Uniprot ID: P13056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NR2C1
Alternative Gene Name: TR2, TR2-11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005897: 73%, ENSRNOG00000006983: 72%
Entrez Gene ID: 7181
Uniprot ID: P13056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV |
Documents & Links for Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation) | |
Datasheet | Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation) at Atlas |
Documents & Links for Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation) | |
Datasheet | Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation) |