Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation)

Catalog No:
ATL-HPA067767-25
$447.00

Description

Product Description

Protein Description: nuclear receptor subfamily 2, group C, member 1
Gene Name: NR2C1
Alternative Gene Name: TR2, TR2-11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005897: 73%, ENSRNOG00000006983: 72%
Entrez Gene ID: 7181
Uniprot ID: P13056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV
Gene Sequence QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV
Gene ID - Mouse ENSMUSG00000005897
Gene ID - Rat ENSRNOG00000006983
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation)
Datasheet Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation)
Datasheet Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation)

Product Description

Protein Description: nuclear receptor subfamily 2, group C, member 1
Gene Name: NR2C1
Alternative Gene Name: TR2, TR2-11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005897: 73%, ENSRNOG00000006983: 72%
Entrez Gene ID: 7181
Uniprot ID: P13056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV
Gene Sequence QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV
Gene ID - Mouse ENSMUSG00000005897
Gene ID - Rat ENSRNOG00000006983
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation)
Datasheet Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation)
Datasheet Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation)