Anti NR2C1 pAb (ATL-HPA067767 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA067767-25

• 

Product Description

Protein Description: nuclear receptor subfamily 2, group C, member 1
Gene Name: NR2C1
Alternative Gene Name: TR2, TR2-11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005897: 73%, ENSRNOG00000006983: 72%
Entrez Gene ID: 7181
Uniprot ID: P13056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV
• Gene Sequence: QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV
• Gene ID - Mouse: ENSMUSG00000005897
• Gene ID - Rat: ENSRNOG00000006983
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.