Description
Product Description
Protein Description: nuclear receptor subfamily 1, group I, member 2
Gene Name: NR1I2
Alternative Gene Name: BXR, ONR1, PAR2, PXR, SXR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022809: 77%, ENSRNOG00000002906: 76%
Entrez Gene ID: 8856
Uniprot ID: O75469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NR1I2
Alternative Gene Name: BXR, ONR1, PAR2, PXR, SXR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022809: 77%, ENSRNOG00000002906: 76%
Entrez Gene ID: 8856
Uniprot ID: O75469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELP |
Gene Sequence | LESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELP |
Gene ID - Mouse | ENSMUSG00000022809 |
Gene ID - Rat | ENSRNOG00000002906 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NR1I2 pAb (ATL-HPA073926) | |
Datasheet | Anti NR1I2 pAb (ATL-HPA073926) Datasheet (External Link) |
Vendor Page | Anti NR1I2 pAb (ATL-HPA073926) at Atlas Antibodies |
Documents & Links for Anti NR1I2 pAb (ATL-HPA073926) | |
Datasheet | Anti NR1I2 pAb (ATL-HPA073926) Datasheet (External Link) |
Vendor Page | Anti NR1I2 pAb (ATL-HPA073926) |