Anti NR1I2 pAb (ATL-HPA073926)

Atlas Antibodies

Catalog No: ATL-HPA073926-25

• 

Product Description

Protein Description: nuclear receptor subfamily 1, group I, member 2
Gene Name: NR1I2
Alternative Gene Name: BXR, ONR1, PAR2, PXR, SXR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022809: 77%, ENSRNOG00000002906: 76%
Entrez Gene ID: 8856
Uniprot ID: O75469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELP
• Gene Sequence: LESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELP
• Gene ID - Mouse: ENSMUSG00000022809
• Gene ID - Rat: ENSRNOG00000002906
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.