Anti NPTN pAb (ATL-HPA072453)

Atlas Antibodies

Catalog No: ATL-HPA072453-25

• 
• 

Product Description

Protein Description: neuroplastin
Gene Name: NPTN
Alternative Gene Name: GP55, GP65, np55, np65, SDFR1, SDR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032336: 92%, ENSRNOG00000009029: 95%
Entrez Gene ID: 27020
Uniprot ID: Q9Y639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFV
• Gene Sequence: PRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFV
• Gene ID - Mouse: ENSMUSG00000032336
• Gene ID - Rat: ENSRNOG00000009029
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.