Protein Description: neuroplastin
Gene Name: NPTN
Alternative Gene Name: GP55, GP65, np55, np65, SDFR1, SDR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032336: 92%, ENSRNOG00000009029: 95%
Entrez Gene ID: 27020
Uniprot ID: Q9Y639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NPTN
Alternative Gene Name: GP55, GP65, np55, np65, SDFR1, SDR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032336: 92%, ENSRNOG00000009029: 95%
Entrez Gene ID: 27020
Uniprot ID: Q9Y639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFV |
Documents & Links for Anti NPTN pAb (ATL-HPA072453) | |
Datasheet | Anti NPTN pAb (ATL-HPA072453) Datasheet (External Link) |
Vendor Page | Anti NPTN pAb (ATL-HPA072453) at Atlas |
Documents & Links for Anti NPTN pAb (ATL-HPA072453) | |
Datasheet | Anti NPTN pAb (ATL-HPA072453) Datasheet (External Link) |
Vendor Page | Anti NPTN pAb (ATL-HPA072453) |