Anti NPSR1 pAb (ATL-HPA007489)

Atlas Antibodies

Catalog No: ATL-HPA007489-25

• 

Product Description

Protein Description: neuropeptide S receptor 1
Gene Name: NPSR1
Alternative Gene Name: GPR154, GPRA, PGR14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043659: 87%, ENSRNOG00000015863: 84%
Entrez Gene ID: 387129
Uniprot ID: Q6W5P4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP
• Gene Sequence: DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP
• Gene ID - Mouse: ENSMUSG00000043659
• Gene ID - Rat: ENSRNOG00000015863
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti NPSR1 pAb (ATL-HPA007489) – 1 Found

Camilleri, Michael; Carlson, Paula; Zinsmeister, Alan R; McKinzie, Sanna; Busciglio, Irene; Burton, Duane; Zucchelli, Marco; D'Amato, Mauro. Neuropeptide S receptor induces neuropeptide expression and associates with intermediate phenotypes of functional gastrointestinal disorders. Gastroenterology. 2010;138(1):98-107.e4.