Protein Description: nuclear protein, ataxia-telangiectasia locus
Gene Name: NPAT
Alternative Gene Name: E14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033054: 59%, ENSRNOG00000024934: 60%
Entrez Gene ID: 4863
Uniprot ID: Q14207
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NPAT
Alternative Gene Name: E14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033054: 59%, ENSRNOG00000024934: 60%
Entrez Gene ID: 4863
Uniprot ID: Q14207
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VSDKSIATDLGKKSEETTVPFPEESIVPAAKPCHRRVLCFDSTTAPVANTQGPNHKMVSQNKERNAVSFPNLDSPNVSSTL |
| Documents & Links for Anti NPAT pAb (ATL-HPA066370) | |
| Datasheet | Anti NPAT pAb (ATL-HPA066370) Datasheet (External Link) |
| Vendor Page | Anti NPAT pAb (ATL-HPA066370) at Atlas |
| Documents & Links for Anti NPAT pAb (ATL-HPA066370) | |
| Datasheet | Anti NPAT pAb (ATL-HPA066370) Datasheet (External Link) |
| Vendor Page | Anti NPAT pAb (ATL-HPA066370) |