Description
Product Description
Protein Description: nuclear protein, ataxia-telangiectasia locus
Gene Name: NPAT
Alternative Gene Name: E14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033054: 59%, ENSRNOG00000024934: 60%
Entrez Gene ID: 4863
Uniprot ID: Q14207
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NPAT
Alternative Gene Name: E14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033054: 59%, ENSRNOG00000024934: 60%
Entrez Gene ID: 4863
Uniprot ID: Q14207
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VSDKSIATDLGKKSEETTVPFPEESIVPAAKPCHRRVLCFDSTTAPVANTQGPNHKMVSQNKERNAVSFPNLDSPNVSSTL |
Gene Sequence | VSDKSIATDLGKKSEETTVPFPEESIVPAAKPCHRRVLCFDSTTAPVANTQGPNHKMVSQNKERNAVSFPNLDSPNVSSTL |
Gene ID - Mouse | ENSMUSG00000033054 |
Gene ID - Rat | ENSRNOG00000024934 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NPAT pAb (ATL-HPA066370) | |
Datasheet | Anti NPAT pAb (ATL-HPA066370) Datasheet (External Link) |
Vendor Page | Anti NPAT pAb (ATL-HPA066370) at Atlas Antibodies |
Documents & Links for Anti NPAT pAb (ATL-HPA066370) | |
Datasheet | Anti NPAT pAb (ATL-HPA066370) Datasheet (External Link) |
Vendor Page | Anti NPAT pAb (ATL-HPA066370) |