Protein Description: neuronal PAS domain protein 1
Gene Name: NPAS1
Alternative Gene Name: bHLHe11, MOP5, PASD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001988: 70%, ENSRNOG00000015376: 70%
Entrez Gene ID: 4861
Uniprot ID: Q99742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NPAS1
Alternative Gene Name: bHLHe11, MOP5, PASD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001988: 70%, ENSRNOG00000015376: 70%
Entrez Gene ID: 4861
Uniprot ID: Q99742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VLWVSHVLSQAEGGQTPLDAFQLPASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGQRIKV |
Documents & Links for Anti NPAS1 pAb (ATL-HPA072259) | |
Datasheet | Anti NPAS1 pAb (ATL-HPA072259) Datasheet (External Link) |
Vendor Page | Anti NPAS1 pAb (ATL-HPA072259) at Atlas |
Documents & Links for Anti NPAS1 pAb (ATL-HPA072259) | |
Datasheet | Anti NPAS1 pAb (ATL-HPA072259) Datasheet (External Link) |
Vendor Page | Anti NPAS1 pAb (ATL-HPA072259) |