Anti NOXO1 pAb (ATL-HPA071540)

Atlas Antibodies

Catalog No: ATL-HPA071540-25

• 

Product Description

Protein Description: NADPH oxidase organizer 1
Gene Name: NOXO1
Alternative Gene Name: P41NOXA, P41NOXB, P41NOXC, SH3PXD5, SNX28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019320: 59%, ENSRNOG00000025117: 62%
Entrez Gene ID: 124056
Uniprot ID: Q8NFA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLETYSRRLLATAERVARSPTITGFFAPQPLDLE
• Gene Sequence: LLETYSRRLLATAERVARSPTITGFFAPQPLDLE
• Gene ID - Mouse: ENSMUSG00000019320
• Gene ID - Rat: ENSRNOG00000025117
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.