Protein Description: nitric oxide synthase 1
Gene Name: NOS1
Alternative Gene Name: nNOS, NOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029361: 91%, ENSRNOG00000001130: 91%
Entrez Gene ID: 4842
Uniprot ID: P29475
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NOS1
Alternative Gene Name: nNOS, NOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029361: 91%, ENSRNOG00000001130: 91%
Entrez Gene ID: 4842
Uniprot ID: P29475
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLD |
| Documents & Links for Anti NOS1 pAb (ATL-HPA069509) | |
| Datasheet | Anti NOS1 pAb (ATL-HPA069509) Datasheet (External Link) |
| Vendor Page | Anti NOS1 pAb (ATL-HPA069509) at Atlas |
| Documents & Links for Anti NOS1 pAb (ATL-HPA069509) | |
| Datasheet | Anti NOS1 pAb (ATL-HPA069509) Datasheet (External Link) |
| Vendor Page | Anti NOS1 pAb (ATL-HPA069509) |