Anti NOS1 pAb (ATL-HPA069509)

Catalog No:
ATL-HPA069509-25
$290.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: nitric oxide synthase 1
Gene Name: NOS1
Alternative Gene Name: nNOS, NOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029361: 91%, ENSRNOG00000001130: 91%
Entrez Gene ID: 4842
Uniprot ID: P29475
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence DHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLD

Documents & Links for Anti NOS1 pAb (ATL-HPA069509)
Datasheet Anti NOS1 pAb (ATL-HPA069509) Datasheet (External Link)
Vendor Page Anti NOS1 pAb (ATL-HPA069509) at Atlas

Documents & Links for Anti NOS1 pAb (ATL-HPA069509)
Datasheet Anti NOS1 pAb (ATL-HPA069509) Datasheet (External Link)
Vendor Page Anti NOS1 pAb (ATL-HPA069509)