Description
Product Description
Protein Description: NOP16 nucleolar protein
Gene Name: NOP16
Alternative Gene Name: HSPC111, HSPC185, LOC51491
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025869: 95%, ENSRNOG00000017284: 95%
Entrez Gene ID: 51491
Uniprot ID: Q9Y3C1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NOP16
Alternative Gene Name: HSPC111, HSPC185, LOC51491
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025869: 95%, ENSRNOG00000017284: 95%
Entrez Gene ID: 51491
Uniprot ID: Q9Y3C1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVD |
Gene Sequence | KGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVD |
Gene ID - Mouse | ENSMUSG00000025869 |
Gene ID - Rat | ENSRNOG00000017284 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NOP16 pAb (ATL-HPA058147 w/enhanced validation) | |
Datasheet | Anti NOP16 pAb (ATL-HPA058147 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NOP16 pAb (ATL-HPA058147 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti NOP16 pAb (ATL-HPA058147 w/enhanced validation) | |
Datasheet | Anti NOP16 pAb (ATL-HPA058147 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NOP16 pAb (ATL-HPA058147 w/enhanced validation) |