Anti NOP16 pAb (ATL-HPA058147 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA058147-25

• 
• 

Product Description

Protein Description: NOP16 nucleolar protein
Gene Name: NOP16
Alternative Gene Name: HSPC111, HSPC185, LOC51491
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025869: 95%, ENSRNOG00000017284: 95%
Entrez Gene ID: 51491
Uniprot ID: Q9Y3C1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVD
• Gene Sequence: KGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVD
• Gene ID - Mouse: ENSMUSG00000025869
• Gene ID - Rat: ENSRNOG00000017284
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.