Anti NOMO1 pAb (ATL-HPA046697)

Catalog No:
ATL-HPA046697-25
$447.00

Description

Product Description

Protein Description: NODAL modulator 1
Gene Name: NOMO1
Alternative Gene Name: PM5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030835: 98%, ENSRNOG00000021118: 99%
Entrez Gene ID: 23420
Uniprot ID: Q15155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEKITVTPSSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTS
Gene Sequence GEKITVTPSSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTS
Gene ID - Mouse ENSMUSG00000030835
Gene ID - Rat ENSRNOG00000021118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NOMO1 pAb (ATL-HPA046697)
Datasheet Anti NOMO1 pAb (ATL-HPA046697) Datasheet (External Link)
Vendor Page Anti NOMO1 pAb (ATL-HPA046697) at Atlas Antibodies

Documents & Links for Anti NOMO1 pAb (ATL-HPA046697)
Datasheet Anti NOMO1 pAb (ATL-HPA046697) Datasheet (External Link)
Vendor Page Anti NOMO1 pAb (ATL-HPA046697)

Product Description

Protein Description: NODAL modulator 1
Gene Name: NOMO1
Alternative Gene Name: PM5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030835: 98%, ENSRNOG00000021118: 99%
Entrez Gene ID: 23420
Uniprot ID: Q15155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEKITVTPSSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTS
Gene Sequence GEKITVTPSSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTS
Gene ID - Mouse ENSMUSG00000030835
Gene ID - Rat ENSRNOG00000021118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NOMO1 pAb (ATL-HPA046697)
Datasheet Anti NOMO1 pAb (ATL-HPA046697) Datasheet (External Link)
Vendor Page Anti NOMO1 pAb (ATL-HPA046697) at Atlas Antibodies

Documents & Links for Anti NOMO1 pAb (ATL-HPA046697)
Datasheet Anti NOMO1 pAb (ATL-HPA046697) Datasheet (External Link)
Vendor Page Anti NOMO1 pAb (ATL-HPA046697)