Description
Product Description
Protein Description: NODAL modulator 1
Gene Name: NOMO1
Alternative Gene Name: PM5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030835: 98%, ENSRNOG00000021118: 99%
Entrez Gene ID: 23420
Uniprot ID: Q15155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NOMO1
Alternative Gene Name: PM5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030835: 98%, ENSRNOG00000021118: 99%
Entrez Gene ID: 23420
Uniprot ID: Q15155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GEKITVTPSSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTS |
Gene Sequence | GEKITVTPSSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTS |
Gene ID - Mouse | ENSMUSG00000030835 |
Gene ID - Rat | ENSRNOG00000021118 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NOMO1 pAb (ATL-HPA046697) | |
Datasheet | Anti NOMO1 pAb (ATL-HPA046697) Datasheet (External Link) |
Vendor Page | Anti NOMO1 pAb (ATL-HPA046697) at Atlas Antibodies |
Documents & Links for Anti NOMO1 pAb (ATL-HPA046697) | |
Datasheet | Anti NOMO1 pAb (ATL-HPA046697) Datasheet (External Link) |
Vendor Page | Anti NOMO1 pAb (ATL-HPA046697) |