Anti NOG pAb (ATL-HPA061318)

Catalog No:
ATL-HPA061318-25
$395.00

Description

Product Description

Protein Description: noggin
Gene Name: NOG
Alternative Gene Name: SYM1, SYNS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048616: 100%, ENSRNOG00000023683: 100%
Entrez Gene ID: 9241
Uniprot ID: Q13253
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATS
Gene Sequence GQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATS
Gene ID - Mouse ENSMUSG00000048616
Gene ID - Rat ENSRNOG00000023683
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NOG pAb (ATL-HPA061318)
Datasheet Anti NOG pAb (ATL-HPA061318) Datasheet (External Link)
Vendor Page Anti NOG pAb (ATL-HPA061318) at Atlas Antibodies

Documents & Links for Anti NOG pAb (ATL-HPA061318)
Datasheet Anti NOG pAb (ATL-HPA061318) Datasheet (External Link)
Vendor Page Anti NOG pAb (ATL-HPA061318)

Product Description

Protein Description: noggin
Gene Name: NOG
Alternative Gene Name: SYM1, SYNS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048616: 100%, ENSRNOG00000023683: 100%
Entrez Gene ID: 9241
Uniprot ID: Q13253
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATS
Gene Sequence GQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATS
Gene ID - Mouse ENSMUSG00000048616
Gene ID - Rat ENSRNOG00000023683
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NOG pAb (ATL-HPA061318)
Datasheet Anti NOG pAb (ATL-HPA061318) Datasheet (External Link)
Vendor Page Anti NOG pAb (ATL-HPA061318) at Atlas Antibodies

Documents & Links for Anti NOG pAb (ATL-HPA061318)
Datasheet Anti NOG pAb (ATL-HPA061318) Datasheet (External Link)
Vendor Page Anti NOG pAb (ATL-HPA061318)