Protein Description: nucleotide-binding oligomerization domain containing 1
Gene Name: NOD1
Alternative Gene Name: CARD4, CLR7.1, NLRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038058: 86%, ENSRNOG00000010629: 88%
Entrez Gene ID: 10392
Uniprot ID: Q9Y239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NOD1
Alternative Gene Name: CARD4, CLR7.1, NLRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038058: 86%, ENSRNOG00000010629: 88%
Entrez Gene ID: 10392
Uniprot ID: Q9Y239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE |
Documents & Links for Anti NOD1 pAb (ATL-HPA074367) | |
Datasheet | Anti NOD1 pAb (ATL-HPA074367) Datasheet (External Link) |
Vendor Page | Anti NOD1 pAb (ATL-HPA074367) at Atlas |
Documents & Links for Anti NOD1 pAb (ATL-HPA074367) | |
Datasheet | Anti NOD1 pAb (ATL-HPA074367) Datasheet (External Link) |
Vendor Page | Anti NOD1 pAb (ATL-HPA074367) |