Protein Description: NOC3-like DNA replication regulator
Gene Name: NOC3L
Alternative Gene Name: AD24, C10orf117, FAD24, FLJ12820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024999: 89%, ENSRNOG00000013965: 89%
Entrez Gene ID: 64318
Uniprot ID: Q8WTT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NOC3L
Alternative Gene Name: AD24, C10orf117, FAD24, FLJ12820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024999: 89%, ENSRNOG00000013965: 89%
Entrez Gene ID: 64318
Uniprot ID: Q8WTT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DDLQLMKDLGQRVSFLTRDLSSSEPVHAKKRKHERIIDKYEKIPRTLQTAPEKELIHLLPIKDKSGIIPQTREKPV |
Documents & Links for Anti NOC3L pAb (ATL-HPA067638) | |
Datasheet | Anti NOC3L pAb (ATL-HPA067638) Datasheet (External Link) |
Vendor Page | Anti NOC3L pAb (ATL-HPA067638) at Atlas |
Documents & Links for Anti NOC3L pAb (ATL-HPA067638) | |
Datasheet | Anti NOC3L pAb (ATL-HPA067638) Datasheet (External Link) |
Vendor Page | Anti NOC3L pAb (ATL-HPA067638) |