Anti NOC2L pAb (ATL-HPA062195)

Atlas Antibodies

Catalog No: ATL-HPA062195-25

• 

Product Description

Protein Description: NOC2-like nucleolar associated transcriptional repressor
Gene Name: NOC2L
Alternative Gene Name: DKFZP564C186, NET15, NET7, NIR, PPP1R112
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095567: 76%, ENSRNOG00000021392: 79%
Entrez Gene ID: 26155
Uniprot ID: Q9Y3T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLGKVQENSAYICSRRQRVSFGVSEQQAVEAWEKLTREEGTPLTLYYSHWRKLRDREIQLEISGKERLEDLNFPEIKRRKMADRKDEDRKQFKDLFDLNSS
• Gene Sequence: LLGKVQENSAYICSRRQRVSFGVSEQQAVEAWEKLTREEGTPLTLYYSHWRKLRDREIQLEISGKERLEDLNFPEIKRRKMADRKDEDRKQFKDLFDLNSS
• Gene ID - Mouse: ENSMUSG00000095567
• Gene ID - Rat: ENSRNOG00000021392
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.