Description
Product Description
Protein Description: NLR family CARD domain containing 5
Gene Name: NLRC5
Alternative Gene Name: CLR16.1, FLJ21709, NOD27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074151: 55%, ENSRNOG00000048222: 50%
Entrez Gene ID: 84166
Uniprot ID: Q86WI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NLRC5
Alternative Gene Name: CLR16.1, FLJ21709, NOD27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074151: 55%, ENSRNOG00000048222: 50%
Entrez Gene ID: 84166
Uniprot ID: Q86WI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLVRCFSTLQWLFRLDISFESQHILLRGDKTSRDMWATGSLPDFPAAAKFLGFRQRCIPRSLCLSECPLEPPSLTRLCATLKDCPGPLELQLSCEFLSDQ |
Gene Sequence | GLVRCFSTLQWLFRLDISFESQHILLRGDKTSRDMWATGSLPDFPAAAKFLGFRQRCIPRSLCLSECPLEPPSLTRLCATLKDCPGPLELQLSCEFLSDQ |
Gene ID - Mouse | ENSMUSG00000074151 |
Gene ID - Rat | ENSRNOG00000048222 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NLRC5 pAb (ATL-HPA074724) | |
Datasheet | Anti NLRC5 pAb (ATL-HPA074724) Datasheet (External Link) |
Vendor Page | Anti NLRC5 pAb (ATL-HPA074724) at Atlas Antibodies |
Documents & Links for Anti NLRC5 pAb (ATL-HPA074724) | |
Datasheet | Anti NLRC5 pAb (ATL-HPA074724) Datasheet (External Link) |
Vendor Page | Anti NLRC5 pAb (ATL-HPA074724) |