Description
Product Description
Protein Description: NK3 homeobox 1
Gene Name: NKX3-1
Alternative Gene Name: BAPX2, NKX3.1, NKX3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022061: 67%, ENSRNOG00000015477: 64%
Entrez Gene ID: 4824
Uniprot ID: Q99801
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NKX3-1
Alternative Gene Name: BAPX2, NKX3.1, NKX3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022061: 67%, ENSRNOG00000015477: 64%
Entrez Gene ID: 4824
Uniprot ID: Q99801
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG |
Gene Sequence | MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG |
Gene ID - Mouse | ENSMUSG00000022061 |
Gene ID - Rat | ENSRNOG00000015477 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation) | |
Datasheet | Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation) | |
Datasheet | Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation) |