Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation)

Catalog No:
ATL-HPA078571-25
$395.00

Description

Product Description

Protein Description: NK3 homeobox 1
Gene Name: NKX3-1
Alternative Gene Name: BAPX2, NKX3.1, NKX3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022061: 67%, ENSRNOG00000015477: 64%
Entrez Gene ID: 4824
Uniprot ID: Q99801
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG
Gene Sequence MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG
Gene ID - Mouse ENSMUSG00000022061
Gene ID - Rat ENSRNOG00000015477
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation)
Datasheet Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation)

Product Description

Protein Description: NK3 homeobox 1
Gene Name: NKX3-1
Alternative Gene Name: BAPX2, NKX3.1, NKX3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022061: 67%, ENSRNOG00000015477: 64%
Entrez Gene ID: 4824
Uniprot ID: Q99801
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG
Gene Sequence MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG
Gene ID - Mouse ENSMUSG00000022061
Gene ID - Rat ENSRNOG00000015477
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation)
Datasheet Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NKX3-1 pAb (ATL-HPA078571 w/enhanced validation)