Protein Description: NK2 homeobox 8
Gene Name: NKX2-8
Alternative Gene Name: Nkx2-9, NKX2.8, NKX2H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058669: 67%, ENSRNOG00000022970: 69%
Entrez Gene ID: 26257
Uniprot ID: O15522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NKX2-8
Alternative Gene Name: Nkx2-9, NKX2.8, NKX2H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058669: 67%, ENSRNOG00000022970: 69%
Entrez Gene ID: 26257
Uniprot ID: O15522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQR |
| Documents & Links for Anti NKX2-8 pAb (ATL-HPA062879) | |
| Datasheet | Anti NKX2-8 pAb (ATL-HPA062879) Datasheet (External Link) |
| Vendor Page | Anti NKX2-8 pAb (ATL-HPA062879) at Atlas |
| Documents & Links for Anti NKX2-8 pAb (ATL-HPA062879) | |
| Datasheet | Anti NKX2-8 pAb (ATL-HPA062879) Datasheet (External Link) |
| Vendor Page | Anti NKX2-8 pAb (ATL-HPA062879) |