Protein Description: NK2 homeobox 4
Gene Name: NKX2-4
Alternative Gene Name: NKX2.4, NKX2D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054160: 97%, ENSRNOG00000012647: 97%
Entrez Gene ID: 644524
Uniprot ID: Q9H2Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NKX2-4
Alternative Gene Name: NKX2.4, NKX2D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054160: 97%, ENSRNOG00000012647: 97%
Entrez Gene ID: 644524
Uniprot ID: Q9H2Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RYSSISRFMGPSAGVNVAGMGSLTGIADAAKSLGPL |
| Documents & Links for Anti NKX2-4 pAb (ATL-HPA074996) | |
| Datasheet | Anti NKX2-4 pAb (ATL-HPA074996) Datasheet (External Link) |
| Vendor Page | Anti NKX2-4 pAb (ATL-HPA074996) at Atlas |
| Documents & Links for Anti NKX2-4 pAb (ATL-HPA074996) | |
| Datasheet | Anti NKX2-4 pAb (ATL-HPA074996) Datasheet (External Link) |
| Vendor Page | Anti NKX2-4 pAb (ATL-HPA074996) |