Anti NIPA2 pAb (ATL-HPA071342)

Atlas Antibodies

Catalog No: ATL-HPA071342-25

• 

Product Description

Protein Description: non imprinted in Prader-Willi/Angelman syndrome 2
Gene Name: NIPA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030452: 88%, ENSRNOG00000012690: 88%
Entrez Gene ID: 81614
Uniprot ID: Q8N8Q9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LESLPVSFRKDEKAMNGNLSNMYEVLNNNEES
• Gene Sequence: LESLPVSFRKDEKAMNGNLSNMYEVLNNNEES
• Gene ID - Mouse: ENSMUSG00000030452
• Gene ID - Rat: ENSRNOG00000012690
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.