Protein Description: non imprinted in Prader-Willi/Angelman syndrome 2
Gene Name: NIPA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030452: 88%, ENSRNOG00000012690: 88%
Entrez Gene ID: 81614
Uniprot ID: Q8N8Q9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NIPA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030452: 88%, ENSRNOG00000012690: 88%
Entrez Gene ID: 81614
Uniprot ID: Q8N8Q9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LESLPVSFRKDEKAMNGNLSNMYEVLNNNEES |
Documents & Links for Anti NIPA2 pAb (ATL-HPA071342) | |
Datasheet | Anti NIPA2 pAb (ATL-HPA071342) Datasheet (External Link) |
Vendor Page | Anti NIPA2 pAb (ATL-HPA071342) at Atlas |
Documents & Links for Anti NIPA2 pAb (ATL-HPA071342) | |
Datasheet | Anti NIPA2 pAb (ATL-HPA071342) Datasheet (External Link) |
Vendor Page | Anti NIPA2 pAb (ATL-HPA071342) |