Anti NIPA2 pAb (ATL-HPA071342)

Catalog No:
ATL-HPA071342-25
$447.00

Description

Product Description

Protein Description: non imprinted in Prader-Willi/Angelman syndrome 2
Gene Name: NIPA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030452: 88%, ENSRNOG00000012690: 88%
Entrez Gene ID: 81614
Uniprot ID: Q8N8Q9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LESLPVSFRKDEKAMNGNLSNMYEVLNNNEES
Gene Sequence LESLPVSFRKDEKAMNGNLSNMYEVLNNNEES
Gene ID - Mouse ENSMUSG00000030452
Gene ID - Rat ENSRNOG00000012690
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NIPA2 pAb (ATL-HPA071342)
Datasheet Anti NIPA2 pAb (ATL-HPA071342) Datasheet (External Link)
Vendor Page Anti NIPA2 pAb (ATL-HPA071342) at Atlas Antibodies

Documents & Links for Anti NIPA2 pAb (ATL-HPA071342)
Datasheet Anti NIPA2 pAb (ATL-HPA071342) Datasheet (External Link)
Vendor Page Anti NIPA2 pAb (ATL-HPA071342)

Product Description

Protein Description: non imprinted in Prader-Willi/Angelman syndrome 2
Gene Name: NIPA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030452: 88%, ENSRNOG00000012690: 88%
Entrez Gene ID: 81614
Uniprot ID: Q8N8Q9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LESLPVSFRKDEKAMNGNLSNMYEVLNNNEES
Gene Sequence LESLPVSFRKDEKAMNGNLSNMYEVLNNNEES
Gene ID - Mouse ENSMUSG00000030452
Gene ID - Rat ENSRNOG00000012690
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NIPA2 pAb (ATL-HPA071342)
Datasheet Anti NIPA2 pAb (ATL-HPA071342) Datasheet (External Link)
Vendor Page Anti NIPA2 pAb (ATL-HPA071342) at Atlas Antibodies

Documents & Links for Anti NIPA2 pAb (ATL-HPA071342)
Datasheet Anti NIPA2 pAb (ATL-HPA071342) Datasheet (External Link)
Vendor Page Anti NIPA2 pAb (ATL-HPA071342)