Anti NIP7 pAb (ATL-HPA059850 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA059850-100

• 
• 

Product Description

Protein Description: NIP7, nucleolar pre-rRNA processing protein
Gene Name: NIP7
Alternative Gene Name: CGI-37, FLJ10296, HSPC031, KD93
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031917: 96%, ENSRNOG00000020391: 96%
Entrez Gene ID: 51388
Uniprot ID: Q9Y221
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYL
• Gene Sequence: ETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYL
• Gene ID - Mouse: ENSMUSG00000031917
• Gene ID - Rat: ENSRNOG00000020391
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.