Anti NINL pAb (ATL-HPA000686)

Atlas Antibodies

Catalog No: ATL-HPA000686-25

• 
• 

Product Description

Protein Description: ninein-like
Gene Name: NINL
Alternative Gene Name: KIAA0980, NLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068115: 47%, ENSRNOG00000027747: 49%
Entrez Gene ID: 22981
Uniprot ID: Q9Y2I6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLELERALKL
• Gene Sequence: LHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLELERALKL
• Gene ID - Mouse: ENSMUSG00000068115
• Gene ID - Rat: ENSRNOG00000027747
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti NINL pAb (ATL-HPA000686) – 1 Found

Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.