Description
Product Description
Protein Description: ninjurin 2
Gene Name: NINJ2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033871: 28%, ENSRNOG00000031643: 32%
Entrez Gene ID: 4815
Uniprot ID: Q9NZG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NINJ2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033871: 28%, ENSRNOG00000031643: 32%
Entrez Gene ID: 4815
Uniprot ID: Q9NZG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAGLSRQLCALSHPKKAAETQTAEPGGAHAVCSRHPVRVKGLEGSEMESARENIDLQPGSSDPRSQPINLN |
Gene Sequence | MAGLSRQLCALSHPKKAAETQTAEPGGAHAVCSRHPVRVKGLEGSEMESARENIDLQPGSSDPRSQPINLN |
Gene ID - Mouse | ENSMUSG00000033871 |
Gene ID - Rat | ENSRNOG00000031643 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NINJ2 pAb (ATL-HPA058980) | |
Datasheet | Anti NINJ2 pAb (ATL-HPA058980) Datasheet (External Link) |
Vendor Page | Anti NINJ2 pAb (ATL-HPA058980) at Atlas Antibodies |
Documents & Links for Anti NINJ2 pAb (ATL-HPA058980) | |
Datasheet | Anti NINJ2 pAb (ATL-HPA058980) Datasheet (External Link) |
Vendor Page | Anti NINJ2 pAb (ATL-HPA058980) |