Anti NIF3L1 pAb (ATL-HPA061466 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061466-25

• 

Product Description

Protein Description: NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae)
Gene Name: NIF3L1
Alternative Gene Name: ALS2CR1, CALS-7, MDS015
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026036: 76%, ENSRNOG00000013446: 82%
Entrez Gene ID: 60491
Uniprot ID: Q9GZT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IYSPHTAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNE
• Gene Sequence: IYSPHTAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNE
• Gene ID - Mouse: ENSMUSG00000026036
• Gene ID - Rat: ENSRNOG00000013446
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.