Description
Product Description
Protein Description: nidogen 2 (osteonidogen)
Gene Name: NID2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021806: 65%, ENSRNOG00000000341: 63%
Entrez Gene ID: 22795
Uniprot ID: Q14112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NID2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021806: 65%, ENSRNOG00000000341: 63%
Entrez Gene ID: 22795
Uniprot ID: Q14112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGVWAFHIGSTSPLDNVRPAAVGDLSAAHSSVPLGRSFSHATALESDYNEDNLDYYDVNEEEAEYLPGEPEEALNGHSSIDVSFQSKVDTKP |
Gene Sequence | PGVWAFHIGSTSPLDNVRPAAVGDLSAAHSSVPLGRSFSHATALESDYNEDNLDYYDVNEEEAEYLPGEPEEALNGHSSIDVSFQSKVDTKP |
Gene ID - Mouse | ENSMUSG00000021806 |
Gene ID - Rat | ENSRNOG00000000341 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NID2 pAb (ATL-HPA058772 w/enhanced validation) | |
Datasheet | Anti NID2 pAb (ATL-HPA058772 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NID2 pAb (ATL-HPA058772 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti NID2 pAb (ATL-HPA058772 w/enhanced validation) | |
Datasheet | Anti NID2 pAb (ATL-HPA058772 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NID2 pAb (ATL-HPA058772 w/enhanced validation) |