Protein Description: Nance-Horan syndrome (congenital cataracts and dental anomalies)
Gene Name: NHS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059493: 91%, ENSRNOG00000030759: 91%
Entrez Gene ID: 4810
Uniprot ID: Q6T4R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NHS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059493: 91%, ENSRNOG00000030759: 91%
Entrez Gene ID: 4810
Uniprot ID: Q6T4R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ATYDSFLEKSPSDKADTSSHFSVDTEGYYTSMHFDCGLKGNKSYVCHYAALGPENGQGVGASPGLPDCAWQDYLDHKRQGRPSISFRKP |
Documents & Links for Anti NHS pAb (ATL-HPA076257) | |
Datasheet | Anti NHS pAb (ATL-HPA076257) Datasheet (External Link) |
Vendor Page | Anti NHS pAb (ATL-HPA076257) at Atlas |
Documents & Links for Anti NHS pAb (ATL-HPA076257) | |
Datasheet | Anti NHS pAb (ATL-HPA076257) Datasheet (External Link) |
Vendor Page | Anti NHS pAb (ATL-HPA076257) |