Protein Description: NHL repeat containing 4
Gene Name: NHLRC4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090113: 78%, ENSRNOG00000039279: 76%
Entrez Gene ID: 283948
Uniprot ID: P0CG21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NHLRC4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090113: 78%, ENSRNOG00000039279: 76%
Entrez Gene ID: 283948
Uniprot ID: P0CG21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VGPGPDGGLAVSEEFGDVRLFGSARQPLGSLGGWTGHTFGCPAGICSNSEGNVIVVDEQ |
Documents & Links for Anti NHLRC4 pAb (ATL-HPA077301) | |
Datasheet | Anti NHLRC4 pAb (ATL-HPA077301) Datasheet (External Link) |
Vendor Page | Anti NHLRC4 pAb (ATL-HPA077301) at Atlas |
Documents & Links for Anti NHLRC4 pAb (ATL-HPA077301) | |
Datasheet | Anti NHLRC4 pAb (ATL-HPA077301) Datasheet (External Link) |
Vendor Page | Anti NHLRC4 pAb (ATL-HPA077301) |