![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101597/181733/atl-hpa076267_anti-ngrn-pab-atl-hpa076267_63401__98415.1681138126.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: neugrin, neurite outgrowth associated
Gene Name: NGRN
Alternative Gene Name: DSC92
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047084: 60%, ENSRNOG00000013553: 55%
Entrez Gene ID: 51335
Uniprot ID: Q9NPE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NGRN
Alternative Gene Name: DSC92
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047084: 60%, ENSRNOG00000013553: 55%
Entrez Gene ID: 51335
Uniprot ID: Q9NPE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFDSNGNFLYR |
| Documents & Links for Anti NGRN pAb (ATL-HPA076267) | |
| Datasheet | Anti NGRN pAb (ATL-HPA076267) Datasheet (External Link) |
| Vendor Page | Anti NGRN pAb (ATL-HPA076267) at Atlas |
| Documents & Links for Anti NGRN pAb (ATL-HPA076267) | |
| Datasheet | Anti NGRN pAb (ATL-HPA076267) Datasheet (External Link) |
| Vendor Page | Anti NGRN pAb (ATL-HPA076267) |