Description
Product Description
Protein Description: nuclear transcription factor, X-box binding 1
Gene Name: NFX1
Alternative Gene Name: MGC20369, NFX2, TEG-42, Tex42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028423: 74%, ENSRNOG00000009015: 74%
Entrez Gene ID: 4799
Uniprot ID: Q12986
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NFX1
Alternative Gene Name: MGC20369, NFX2, TEG-42, Tex42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028423: 74%, ENSRNOG00000009015: 74%
Entrez Gene ID: 4799
Uniprot ID: Q12986
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSPPPCHLSRQVPYDEISAVHQHSYHPSGSKPKSQQTSFQSSPCNKSPKSHGLQNQPWQKLRNEKHHIRVKKAQSLAEQTSDTA |
Gene Sequence | SSPPPCHLSRQVPYDEISAVHQHSYHPSGSKPKSQQTSFQSSPCNKSPKSHGLQNQPWQKLRNEKHHIRVKKAQSLAEQTSDTA |
Gene ID - Mouse | ENSMUSG00000028423 |
Gene ID - Rat | ENSRNOG00000009015 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NFX1 pAb (ATL-HPA073519) | |
Datasheet | Anti NFX1 pAb (ATL-HPA073519) Datasheet (External Link) |
Vendor Page | Anti NFX1 pAb (ATL-HPA073519) at Atlas Antibodies |
Documents & Links for Anti NFX1 pAb (ATL-HPA073519) | |
Datasheet | Anti NFX1 pAb (ATL-HPA073519) Datasheet (External Link) |
Vendor Page | Anti NFX1 pAb (ATL-HPA073519) |
Citations
Citations for Anti NFX1 pAb (ATL-HPA073519) – 1 Found |
Chintala, Sreenivasulu; Levan, Justine; Robinson, Kristin; Quist, Kevin; Katzenellenbogen, Rachel A. Genes Regulated by HPV 16 E6 and High Expression of NFX1-123 in Cervical Cancers. Oncotargets And Therapy. 13( 32617009):6143-6156. PubMed |