Protein Description: nuclear transcription factor, X-box binding 1
Gene Name: NFX1
Alternative Gene Name: MGC20369, NFX2, TEG-42, Tex42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028423: 74%, ENSRNOG00000009015: 74%
Entrez Gene ID: 4799
Uniprot ID: Q12986
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NFX1
Alternative Gene Name: MGC20369, NFX2, TEG-42, Tex42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028423: 74%, ENSRNOG00000009015: 74%
Entrez Gene ID: 4799
Uniprot ID: Q12986
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSPPPCHLSRQVPYDEISAVHQHSYHPSGSKPKSQQTSFQSSPCNKSPKSHGLQNQPWQKLRNEKHHIRVKKAQSLAEQTSDTA |
| Documents & Links for Anti NFX1 pAb (ATL-HPA073519) | |
| Datasheet | Anti NFX1 pAb (ATL-HPA073519) Datasheet (External Link) |
| Vendor Page | Anti NFX1 pAb (ATL-HPA073519) at Atlas |
| Documents & Links for Anti NFX1 pAb (ATL-HPA073519) | |
| Datasheet | Anti NFX1 pAb (ATL-HPA073519) Datasheet (External Link) |
| Vendor Page | Anti NFX1 pAb (ATL-HPA073519) |
| Citations for Anti NFX1 pAb (ATL-HPA073519) – 1 Found |
| Chintala, Sreenivasulu; Levan, Justine; Robinson, Kristin; Quist, Kevin; Katzenellenbogen, Rachel A. Genes Regulated by HPV 16 E6 and High Expression of NFX1-123 in Cervical Cancers. Oncotargets And Therapy. 13( 32617009):6143-6156. PubMed |