Protein Description: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta
Gene Name: NFKBIZ
Alternative Gene Name: FLJ34463, INAP, MAIL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035356: 49%, ENSRNOG00000031163: 39%
Entrez Gene ID: 64332
Uniprot ID: Q9BYH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NFKBIZ
Alternative Gene Name: FLJ34463, INAP, MAIL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035356: 49%, ENSRNOG00000031163: 39%
Entrez Gene ID: 64332
Uniprot ID: Q9BYH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CQPFQVRGSQQMIDQASLYQYSPQNQHVEQQPHYTHKPTLEYSPFPIPPQSPAYEPNLFDGPESQFCPNQSLVSLLGDQRESENIANPM |
| Documents & Links for Anti NFKBIZ pAb (ATL-HPA075363) | |
| Datasheet | Anti NFKBIZ pAb (ATL-HPA075363) Datasheet (External Link) |
| Vendor Page | Anti NFKBIZ pAb (ATL-HPA075363) at Atlas |
| Documents & Links for Anti NFKBIZ pAb (ATL-HPA075363) | |
| Datasheet | Anti NFKBIZ pAb (ATL-HPA075363) Datasheet (External Link) |
| Vendor Page | Anti NFKBIZ pAb (ATL-HPA075363) |