Description
Product Description
Protein Description: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta
Gene Name: NFKBIB
Alternative Gene Name: IKBB, TRIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030595: 89%, ENSRNOG00000020063: 86%
Entrez Gene ID: 4793
Uniprot ID: Q15653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NFKBIB
Alternative Gene Name: IKBB, TRIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030595: 89%, ENSRNOG00000020063: 86%
Entrez Gene ID: 4793
Uniprot ID: Q15653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVL |
Gene Sequence | EEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVL |
Gene ID - Mouse | ENSMUSG00000030595 |
Gene ID - Rat | ENSRNOG00000020063 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NFKBIB pAb (ATL-HPA063734) | |
Datasheet | Anti NFKBIB pAb (ATL-HPA063734) Datasheet (External Link) |
Vendor Page | Anti NFKBIB pAb (ATL-HPA063734) at Atlas Antibodies |
Documents & Links for Anti NFKBIB pAb (ATL-HPA063734) | |
Datasheet | Anti NFKBIB pAb (ATL-HPA063734) Datasheet (External Link) |
Vendor Page | Anti NFKBIB pAb (ATL-HPA063734) |