Anti NFATC4 pAb (ATL-HPA076526)

Catalog No:
ATL-HPA076526-25
$360.00
Protein Description: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4
Gene Name: NFATC4
Alternative Gene Name: NFAT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023411: 79%, ENSRNOG00000020482: 81%
Entrez Gene ID: 4776
Uniprot ID: Q14934
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence ETRGTTGCAQPPAVSFLPRPFPSDPYGGRGSSFSLGLPFSPPAPFRPPPLPASPPLEGPFPSQSDVHPLPAEGYNKVGPGYGPGE

Documents & Links for Anti NFATC4 pAb (ATL-HPA076526)
Datasheet Anti NFATC4 pAb (ATL-HPA076526) Datasheet (External Link)
Vendor Page Anti NFATC4 pAb (ATL-HPA076526) at Atlas

Documents & Links for Anti NFATC4 pAb (ATL-HPA076526)
Datasheet Anti NFATC4 pAb (ATL-HPA076526) Datasheet (External Link)
Vendor Page Anti NFATC4 pAb (ATL-HPA076526)