Protein Description: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4
Gene Name: NFATC4
Alternative Gene Name: NFAT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023411: 79%, ENSRNOG00000020482: 81%
Entrez Gene ID: 4776
Uniprot ID: Q14934
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NFATC4
Alternative Gene Name: NFAT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023411: 79%, ENSRNOG00000020482: 81%
Entrez Gene ID: 4776
Uniprot ID: Q14934
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ETRGTTGCAQPPAVSFLPRPFPSDPYGGRGSSFSLGLPFSPPAPFRPPPLPASPPLEGPFPSQSDVHPLPAEGYNKVGPGYGPGE |
Documents & Links for Anti NFATC4 pAb (ATL-HPA076526) | |
Datasheet | Anti NFATC4 pAb (ATL-HPA076526) Datasheet (External Link) |
Vendor Page | Anti NFATC4 pAb (ATL-HPA076526) at Atlas |
Documents & Links for Anti NFATC4 pAb (ATL-HPA076526) | |
Datasheet | Anti NFATC4 pAb (ATL-HPA076526) Datasheet (External Link) |
Vendor Page | Anti NFATC4 pAb (ATL-HPA076526) |