Anti NFATC3 pAb (ATL-HPA050665)

Atlas Antibodies

Catalog No: ATL-HPA050665-25

• 

Product Description

Protein Description: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
Gene Name: NFATC3
Alternative Gene Name: NFAT4, NFATX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031902: 79%, ENSRNOG00000054264: 80%
Entrez Gene ID: 4775
Uniprot ID: Q12968
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHLPQLQCRDESVSKEQHMIPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSGLVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQP
• Gene Sequence: SHLPQLQCRDESVSKEQHMIPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSGLVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQP
• Gene ID - Mouse: ENSMUSG00000031902
• Gene ID - Rat: ENSRNOG00000054264
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.