Polyclonal Antibody against Human NFAT5, Gene description: nuclear factor of activated T cells 5, Alternative Gene Names: KIAA0827, NF-AT5, NFATL1, NFATZ, OREBP, TONEBP, Validated applications: ICC, Uniprot ID: O94916, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications |
| Application |
ICC |
| Reactivity |
Human |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene Sequence |
TTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISH |
| Gene ID - Mouse |
ENSMUSG00000003847 |
| Gene ID - Rat |
ENSMUSG00000003847 |
| Buffer |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
