Polyclonal Antibody against Human NFAT5, Gene description: nuclear factor of activated T cells 5, Alternative Gene Names: KIAA0827, NF-AT5, NFATL1, NFATZ, OREBP, TONEBP, Validated applications: ICC, Uniprot ID: O94916, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISH |
Gene ID - Mouse | ENSMUSG00000003847 |
Gene ID - Rat | ENSMUSG00000003847 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti-NFAT5 pAb (ATL-HPA074040) | |
Vendor Page | Anti-NFAT5 pAb (ATL-HPA074040) at Atlas |
Documents & Links for Anti-NFAT5 pAb (ATL-HPA074040) | |
Vendor Page | Anti-NFAT5 pAb (ATL-HPA074040) |