Anti NEURL2 pAb (ATL-HPA059842)

Atlas Antibodies

Catalog No: ATL-HPA059842-25

• 

Product Description

Protein Description: neuralized E3 ubiquitin protein ligase 2
Gene Name: NEURL2
Alternative Gene Name: C20orf163, dJ337O18.6, FLJ30259, Ozz, Ozz-E3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039873: 97%, ENSRNOG00000015797: 97%
Entrez Gene ID: 140825
Uniprot ID: Q9BR09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YELNVLPPTARRSRLGVLFCPRPDGTADMHIIINGEDMGPSARGLPAAQPLYAVVDVFASTKSVRLVQLEYGL
• Gene Sequence: YELNVLPPTARRSRLGVLFCPRPDGTADMHIIINGEDMGPSARGLPAAQPLYAVVDVFASTKSVRLVQLEYGL
• Gene ID - Mouse: ENSMUSG00000039873
• Gene ID - Rat: ENSRNOG00000015797
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.