Protein Description: neuropilin (NRP) and tolloid (TLL)-like 1
Gene Name: NETO1
Alternative Gene Name: BCTL1, BTCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050321: 100%, ENSRNOG00000014006: 100%
Entrez Gene ID: 81832
Uniprot ID: Q8TDF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NETO1
Alternative Gene Name: BCTL1, BTCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050321: 100%, ENSRNOG00000014006: 100%
Entrez Gene ID: 81832
Uniprot ID: Q8TDF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PIIGRFCGQQNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKD |
| Documents & Links for Anti NETO1 pAb (ATL-HPA064630) | |
| Datasheet | Anti NETO1 pAb (ATL-HPA064630) Datasheet (External Link) |
| Vendor Page | Anti NETO1 pAb (ATL-HPA064630) at Atlas |
| Documents & Links for Anti NETO1 pAb (ATL-HPA064630) | |
| Datasheet | Anti NETO1 pAb (ATL-HPA064630) Datasheet (External Link) |
| Vendor Page | Anti NETO1 pAb (ATL-HPA064630) |