Protein Description: nucleolus and neural progenitor protein
Gene Name: NEPRO
Alternative Gene Name: C3orf17, DKFZP434F2021, NET17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036208: 59%, ENSRNOG00000013721: 52%
Entrez Gene ID: 25871
Uniprot ID: Q6NW34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NEPRO
Alternative Gene Name: C3orf17, DKFZP434F2021, NET17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036208: 59%, ENSRNOG00000013721: 52%
Entrez Gene ID: 25871
Uniprot ID: Q6NW34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FTFPSDITEFLGQPYFEAFKKKMPIAFAAKGINKLLNKLFLINEQSPRASEETLLGISKKAKQMKINVQNNVDLG |
Documents & Links for Anti NEPRO pAb (ATL-HPA069654) | |
Datasheet | Anti NEPRO pAb (ATL-HPA069654) Datasheet (External Link) |
Vendor Page | Anti NEPRO pAb (ATL-HPA069654) at Atlas |
Documents & Links for Anti NEPRO pAb (ATL-HPA069654) | |
Datasheet | Anti NEPRO pAb (ATL-HPA069654) Datasheet (External Link) |
Vendor Page | Anti NEPRO pAb (ATL-HPA069654) |