Anti NELFCD pAb (ATL-HPA074936)

Catalog No:
ATL-HPA074936-25
$447.00

Description

Product Description

Protein Description: negative elongation factor complex member C/D
Gene Name: NELFCD
Alternative Gene Name: HSPC130, NELF-C, NELF-D, TH1, TH1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016253: 98%, ENSRNOG00000047874: 64%
Entrez Gene ID: 51497
Uniprot ID: Q8IXH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCH
Gene Sequence KRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCH
Gene ID - Mouse ENSMUSG00000016253
Gene ID - Rat ENSRNOG00000047874
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NELFCD pAb (ATL-HPA074936)
Datasheet Anti NELFCD pAb (ATL-HPA074936) Datasheet (External Link)
Vendor Page Anti NELFCD pAb (ATL-HPA074936) at Atlas Antibodies

Documents & Links for Anti NELFCD pAb (ATL-HPA074936)
Datasheet Anti NELFCD pAb (ATL-HPA074936) Datasheet (External Link)
Vendor Page Anti NELFCD pAb (ATL-HPA074936)

Product Description

Protein Description: negative elongation factor complex member C/D
Gene Name: NELFCD
Alternative Gene Name: HSPC130, NELF-C, NELF-D, TH1, TH1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016253: 98%, ENSRNOG00000047874: 64%
Entrez Gene ID: 51497
Uniprot ID: Q8IXH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCH
Gene Sequence KRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCH
Gene ID - Mouse ENSMUSG00000016253
Gene ID - Rat ENSRNOG00000047874
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NELFCD pAb (ATL-HPA074936)
Datasheet Anti NELFCD pAb (ATL-HPA074936) Datasheet (External Link)
Vendor Page Anti NELFCD pAb (ATL-HPA074936) at Atlas Antibodies

Documents & Links for Anti NELFCD pAb (ATL-HPA074936)
Datasheet Anti NELFCD pAb (ATL-HPA074936) Datasheet (External Link)
Vendor Page Anti NELFCD pAb (ATL-HPA074936)