Protein Description: negative elongation factor complex member C/D
Gene Name: NELFCD
Alternative Gene Name: HSPC130, NELF-C, NELF-D, TH1, TH1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016253: 98%, ENSRNOG00000047874: 64%
Entrez Gene ID: 51497
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NELFCD
Alternative Gene Name: HSPC130, NELF-C, NELF-D, TH1, TH1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016253: 98%, ENSRNOG00000047874: 64%
Entrez Gene ID: 51497
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCH |
Documents & Links for Anti NELFCD pAb (ATL-HPA066262) | |
Datasheet | Anti NELFCD pAb (ATL-HPA066262) Datasheet (External Link) |
Vendor Page | Anti NELFCD pAb (ATL-HPA066262) at Atlas |
Documents & Links for Anti NELFCD pAb (ATL-HPA066262) | |
Datasheet | Anti NELFCD pAb (ATL-HPA066262) Datasheet (External Link) |
Vendor Page | Anti NELFCD pAb (ATL-HPA066262) |